PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA007336-PA
Common NameOsI_05482
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 103aa    MW: 11086.7 Da    PI: 11.4243
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA007336-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF901.2e-285099251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rie+ + rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++g+ly ++s
  BGIOSGA007336-PA 50 RIEDATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPRGRLYQFAS 99
                      8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.71641101IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-3541100IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.24E-2743101IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-294363IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004397IPR002100Transcription factor, MADS-box
PfamPF003196.5E-275097IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-296378IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-297899IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MAAAAAGMGG GGGVQHQETT TTVVQVAAEA SRKKVEVRSA GRRGRREMRR IEDATSRQVT  60
FSKRRSGLLK KAFELSVLCD AEVALIVFSP RGRLYQFASA SSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D3e-1943103262Myocyte-specific enhancer factor 2A
3mu6_C3e-1943103262Myocyte-specific enhancer factor 2A
3mu6_B3e-1943103262Myocyte-specific enhancer factor 2A
3mu6_A3e-1943103262Myocyte-specific enhancer factor 2A
1egw_D4e-1943103262MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-1943103262MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-1943103262MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A4e-1943103262MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J5e-1943103262Myocyte-specific enhancer factor 2A
3p57_I5e-1943103262Myocyte-specific enhancer factor 2A
3p57_D5e-1943103262Myocyte-specific enhancer factor 2A
3p57_C5e-1943103262Myocyte-specific enhancer factor 2A
3p57_B5e-1943103262Myocyte-specific enhancer factor 2A
3p57_A5e-1943103262Myocyte-specific enhancer factor 2A
3kov_J5e-1943103262Myocyte-specific enhancer factor 2A
3kov_I5e-1943103262Myocyte-specific enhancer factor 2A
3kov_B5e-1943103262Myocyte-specific enhancer factor 2A
3kov_A5e-1943103262Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0040491e-174AP004049.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1212_C06.
GenBankAP0067201e-174AP006720.1 Oryza sativa Japonica Group genomic DNA, chromosome 2, clone:OJA1212_C06.
GenBankAP0149581e-174AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625202.18e-66PREDICTED: MADS-box protein SOC1-like isoform X1
RefseqXP_015625203.18e-66PREDICTED: MADS-box protein SOC1-like isoform X2
SwissprotP0C5B22e-32MAD56_ORYSJ; MADS-box transcription factor 56
TrEMBLA2WZT91e-67A2WZT9_ORYSI; Putative uncharacterized protein
TrEMBLQ6YPH11e-67Q6YPH1_ORYSJ; MADS-box protein PTM5-like
TrEMBLA0A0P0VDS56e-66A0A0P0VDS5_ORYSJ; Os02g0104100 protein
STRINGBGIOSGA007336-PA4e-67(Oryza sativa Indica Group)
STRINGLOC_Os02g01355.13e-65(Oryza sativa Japonica Group)
STRINGLOC_Os02g01365.14e-63(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.14e-28AGAMOUS-like 14